Archives of Medical Science

Full text

4/2009 vol. 5

Mytilus edulis opiate processes

Arch Med Sci 2009; 5, 4: 618-625
Data publikacji online: 2009/12/30
Article file
Mytilus.pdf
Opioid peptides
Previous studies demonstrated the presence of Met-enkephalin, Leu-enkephalin and Met-enkephalin-Arg6-Phe7 in the nervous system of Mytilus edulis along with highly selective opioid receptors (see Leung and Stefano, 1987 [1-3]). The demonstration of Met-enkephalin-like material in the hemolymph and immunocytes of M. edulis was carried out by means of high pressure liquid chromatography (HPLC) and radioimmuno-assay (RIA) [4-8].
In addition it was determined, in part, how neuropeptides in the hemolymph are degraded or their action terminated, explaining the difficulty in obtaining them in the first place. In mammals CD10 (CALLA, common acute lymphoblastic leukemia antigen/neutral endopeptidase 24.11; NEP, “enkephalinase”) hydrolyzes a number of naturally occurring peptides including the endogenous opioid pentapeptides Met- and Leu-enkephalin [9, 10]. This enzyme in the mammalian brain has been termed “enkephalinase”. In invertebrate organisms, such as the mollusk M. edulis, Met-enkephalin triggers inflammatory responses by inducing morphological changes, directed migration, and aggregation of hemocytes [4-9]. M. edulis hemocytes express a CD10/NEP related structure and abrogation of CD10/NEP enzymatic activity reduces the amount of Met-enkephalin required for hemocyte activation by five orders of magnitude [9]. Human CD10+ polymorphonuclear leukocytes are similarly responsive. Thus, a precise mammalian-like mechanism for degrading peptides in the inver-tebrate immune/defense system is present [10].
Additionally, Met-enkephalin is degraded by other peptidases present in the hemolymph fluid and hemocyte membrane suspension of M. edulis [11]. Degradation of Met-enkephalin is rapid in the fluid and slower in the membrane preparation [12]. Aminopeptidase activity is bestatin sensitive in hemocyte membrane and highest in the fluid of the hemolymph which appears to have a component which is insensitive to inhibition [13-16]. Angiotensin converting enzyme activity is found only in the fluid of the hemolymph. Carboxypeptidase and NEP are membrane bound and the former appears to predominate. Thus, invertebrate immune tissues contain the machinery to digest, as well as process, peptidergic signal molecules.
Importantly, opioid peptides and their precursors have been identified in invertebrate tissues and they contain either identical or close to identical sequences as found in mammals [17]. A mam-malian-like proenkephalin peptide in invertebrates was surmised from studies demonstrating the presence of smaller peptides that are found within this precursor. The opioid peptides Met- and Leu-enkephalin, as well as Met-enkephalin-Arg-Phe, were isolated and sequenced from M. edulis neural tissues [18, 19]. Recently, a proenkephalin-like peptide was identified in the immunocytes of M. edulis [20, 21]. M. edulis proenkephalin exhibits a high sequence identity with human and guinea pig proenkephalin (39 and 50%, respectively). This proenkephalin contains Met- and Leu-enkephalin in a ratio of 3 : 1 for M. edulis. It also possesses Met-enkephalin-Arg-Gly-Leu and Met-enkephalin-Arg-Phe that are flanked by dibasic amino acid residues, demonstrating cleavage sites. Furthermore, using both sequence comparison and a specific antiserum raised against bovine proenkephalin A (209-237), the enkelytin peptide, FAEPLPSEEEGESYSKEVPE-MEKRYGGFM, was identified as proenkephalin and it exhibited a sequence identity of 98% with mammalian enkelytin [22].
M. edulis also contains a prodyn molecule in its hemocytes [20, 23]. M. edulis prodyn contains, aneo-endorphin, dynorphin-A and dynorphin-B at the C-terminus, exhibiting 100, 70.5, and 85% sequence identity with the rat prodyn-derived counterparts, respectively [20, 23]. The number of Leu-enkephalins in this precursor is identical to that found in vertebrates. M. edulis prodyn is distin-guished from that described earlier in leeches in that the N-terminus is longer. Additionally, the presence of an orphanin FQ-like peptide, exhibiting 50% sequence homology with that found in mammals, was found [23].
Briefly, besides opioid processes catechola-minergic processes are also found in M. edulis tissues, resembling there invertebrate counterparts [24]. Additionally, estrogen signaling exists in these tissues as well, again resembling those processes found in mammals [25-28].

Receptors
The effects of the naturally occurring opioid neuropeptide deltorphin I, isolated from amphibian skin, on immunoregulatory activities were studied in invertebrates. (D-Ala2) Deltorphin I binding and pharmacological studies have provided evidence for a special subtype of delta opioid receptor, d2, on human and invertebrate immune cells [29-31]. The high potency of this compound parallels that of Met-enkephalin previously demonstrated in vertebrate plasma and invertebrate hemolymph. In cold saturation experiments a single high affinity binding site was revealed for M. edulis immunocyte membrane homogenates. The ability of a variety of other opioids to displace specifically bound 3H-DAMA also was investigated. The opioid peptides were effective in the following decreasing order: deltorphin I = DAMA > [Met]enkephalin> DADLE > DPDPE. By contrast, the mu and kappa ligands DAGO and dynorphin 1-17 were quite weak [31]. The results obtained with deltorphin I support the view that the special role played by endogenous Met-enkephalin in immunobiological activities of vertebrates and invertebrates is mediated by a special subtype of delta opioid receptor, d2. This site is also sensitive to the inhibitory influence of naltrindole further documenting its identity as d2 [32, 33] and its role in immunocyte activation. It is of interest to note that this new receptor subtype was first demonstrated in an invertebrate and then found on human granulocytes [31]. Thus, opioid peptides appear to have an immunocyte stimulatory action (induce chemotaxis) in both groups of animals via this novel opioid receptor subtype [32, 33].

Opiate alkaloids
Morphine-like and codeine-like substances were demonstrated in the pedal ganglia, hemolymph and mantle tissues of the mollusk M. edulis [34]. The pharmacological activities of the endogenous morphine-like material resemble those of authentic morphine. Both substances counteracted, in a dose dependent manner, the stimulatory effect of tumor necrosis factor (TNF)-a or interleukin (IL)-1a on human monocytes and M. edulis immunocytes. The immunosuppressive effect of this opiate material expresses itself in a lowering of chemotactic activity, cellular velocity and adherence, as well as making active immunocytes inactive, i.e., rounded [34, 35]. Codeine mimics the activity of authentic morphine, but only at much higher concentrations. These pharmacological effects of morphine on im-munocytes are consistent with those actions attributed to opiates reported in the literature [32]. Indeed, it has been surmised that morphinergic transmission may regulate the down regulation of immune activation [32].
Furthermore, a specific, high-affinity and novel receptor site (µ3) for morphine has been identified on human monocytes as well as M. edulis immunocytes [34]. Scatchard analysis revealed a single relatively high affinity binding site. A variety of opioids, tested by two methods, were found to be ineffective in displacing specifically bound
3-dihydromorphine (DHM) [34]. The discovery of this receptor site mediating opiate effects also was first found in an invertebrate and then in man, further demonstrating the value of the comparative approach [34].
Using primers derived from the human neuronal mu1 opiate receptor and reverse transcription-polymerase chain reaction (RT-PCR), we found mu transcripts in M. edulis pedal ganglia, substantiating the earlier observation [36]. Sequence analysis of the RT-PCR products revealed 95% identity with the neuronal human mu1 receptor. Furthermore, interleukin-1 and morphine exposure to excised pedal ganglia resulted in up- and down-regulation of the mu receptor transcripts, respectively [36]. This study provides molecular evidence that mu-type opiate receptors are expressed in molluskan ganglia, suggesting that they first appear in invertebrate organisms and are retained during evolution. Interestingly, this receptor has also been identified in both human brain tissue and human white blood cells as well [37, 38]. It has also been isolated, sequenced and cloned in human tissues and determined to be a truncated mu-1 like receptor [37, 39, 40].

Opioid-cytokine link
Opioid induction of an interleukin 1-like substance in M. edulis pedal ganglia and immunocytes has been demonstrated [41-46]. Recombinant human IL-1 can induce the formation of a TNF-like substance, as well as initiate specific immunocyte conformational changes that are interpreted as activation in immunocytes [41]. Both the immune and nervous system of M. edulis contain an IL-1-like molecule [11, 46]. In nervous tissue it is apparently localized in microglial cells [11]. Opioid challenge can induce the formation of an endogenous IL-1-type molecule that stimulates immunocytes as does authentic IL-1 [11, 46-48]. This immunocyte stimulation can be blocked by specific IL-1 antibody. DAMA induced stimulation of the production of an IL-1-like substance is shared by both the immune and nervous system. In M. edulis, recombinant human IL-6, although not activating cells directly, potentiated IL-1 activation of immunocytes [42, 43, 45]. Furthermore a irIL-6 appears to be present in M. edulis and the insect Leucophaea hemolymph (0.82 ng/ml) [43]. It was also found that irIL-6 is produced in pedal ganglia in response to the pharmacological challenge of the Met-enkephalin analogue DAMA. These data also imply that immune signal molecules may have functions that transcend immunomodulation.

Morphine biosynthesis in Mytilus
Morphine and morphine-6-glucuronide, a mor-phine metabolite, have been identified and quantified in Mytilus edulis pedal ganglia by high performance liquid chromatography coupled to electrochemical detection [49]. These opiate alkaloids were further identified by both gas-chromatography mass spectrometry and nanoflow electrospray ionization double quadrupole orthogonal acceleration Time of Flight mass spectrometry. In animals that were starved, the morphine levels increased significantly compared to controls. Tetrahydropapaveroline and reticuline, isoquinoline alkaloids, morphine precursors, were purified and identified in pedal ganglia as well [50]. These studies demonstrate that opiate alkaloids are present as naturally occurring signal molecules whose levels respond to stress, i.e., starvation.
In M. edulis, endogenous morphine level in the ganglia statistically increased after their incubation with reticuline, tyrosine and tetrahy-dropapaveroline [51, 52]. Reticuline does not stimulate ganglionic NO release, as do the other morphine precursors [53]. Furthermore, in binding displacement experiments both reticuline and salutaridine (another morphine precursor) exhibit no binding affinity for the pedal ganglia mu opiate receptor subtype [53, 54]. Injection of intact, whole healthy animals with reticuline or L-DOPA also results in significantly higher endogenous ganglionic morphine levels [52]. Incubation with quinidine and/or AMPT diminished ganglionic morphine and dopamine synthesis at various steps in the synthesis process [52]. It was also demonstrated that CYP2D6 mediates the tyramine to dopamine step in this process, as did tyrosine hydroxylase in the step from tyrosine to L-DOPA [52]. Furthermore, via RT-PCR, a cDNA fragment of the CYP2D6 enzyme in the ganglia, which exhibits 94% sequence identity with its human counterpart, was identified [55, 56]. Other studies demonstrate critical link with opiate alkaloid synthesis and actions associated with morphine [55, 57].

Opiate alkaloid function in Mytilus
As noted earlier, given the presence of morphine select receptors as well as the opiate alkaloid itself functions associated it also became evident. In an effort to demonstrate possible functional roles of morphine in M. edulis, its presence was examined in the course of a stressful situation brought about by experimental intervention [34, 47]. In animals having been subjected to electrical stimulation of the pedal ganglia morphine down regulated immune and motor responses caused by the stimulus in a naloxone sensitive manner. Examination of the levels of endogenous morphine-like material revealed a significant increase in the hemolymph and in the pedal ganglia taken from the 30-h post electrical stimulation group. The deactivating influence of opiate substances in both systems has to be interpreted in context with the body of information on immunoregulation, particularly immunostimulating activities of opioid peptides and other messenger molecules. The need for a functional interaction of regulatory factors with opposite effects can be considered to be enhanced under abnormal conditions. This speaks for a ge-neral and yet specific role of morphine in calming or terminating the state of alertness created by the initial release of endogenous opioids and/or cytokines [32]. This same role of naturally occurring morphine as an immune down-regulating molecule has been proposed for morphine in CNS [32]. It also may represent a common protective mechanism via the stress followed by relaxation, if appropriate [58].
In another study the concept of the existence in insects and mollusks of a distinctive class of neuroglial cells, comparable to vertebrate microglia, was examined during surgical stress [59]. The evidence presented was as valid as that used in reference to the separate status of vertebrate microglia, i.e., the demonstration of a close structural and functional relationship of these cells with cells of the immune system. The excision of ganglia from three invertebrate species (the mollusks Planorbarius corneus and Mytilus edulis, and the insect Leucophaea maderae), and their maintenance in incubation media, led to an exodus of small cells and their accumulation in the culture dish [59]. During this process, they underwent conformational changes from stellate to rounded, and then to more or less ameboid, comparable to those indicative of the process of activation in the animals’ immunocytes. Functional characteristics, which these translocated microglia-like cells share with immunocytes, are motility, phagocytotic activity, and adherence to the culture dish. An additional phenomenon of particular interest for the classification of microglial elements is their response to morphine [59]. At a concentration of 10–6 M, this drug inhibits not only the number of cells emerging from the excised ganglia, but also the degree of their transformation to the “active” ameboid form. This dose-dependent
and naloxone-sensitive effect of morphine on microglial cells parallels that on activated immunocytes of the same species [34]. Corresponding results demonstrating an inhibitory effect of morphine on mobilized microglial cells of the frog Rana pipieus indicate that this relationship between the two cell types under consideration also exists in vertebrates [59]. Binding and displacement experiments with membrane homogenates of microglial cells as well as immunocytes of M. edulis have shown that the effects of morphine on both cell types are mediated by the same special opiate receptor µ3 [59].

Opiate coupled nitric oxide signaling
Nitric oxide (NO) serves many functions, including free radical scavenger, anti-bacterial and - viral and widespread gaseous messenger actions [60-62]. In numerous reports we also have demonstrated that the novel opiate receptor mu3, which is opiate alkaloid selective and opioid peptide insensitive, is coupled to constitutive nitric oxide release (cNOS) in M. edulis tissues [34, 63-66]. In M. edulis, microglia egress from ganglia, which morphine inhibits, was found to operate via NO release [67]. Taken together, these data demonstrate that morphine can stimulate NO release in cells obtained from an invertebrate that represents an animal 500 million years divergent in evolution from man, underscoring the significance of this process and further substantiating the critical importance of morphine as a naturally occurring signal molecule [68].
The morphine metabolite morphine-6-glucuronide (M6G) also stimulates pedal ganglia cNOS-derived NO release at identical concentrations and similar peak levels as morphine [69, 70]. However, the classic opiate antagonist, naloxone, only blocked the ability of morphine to stimulate cNOS-derived NO release and not that of M6G. CTOP, a mu-specific antagonist, blocked the ability of M6G to induce cNOS-derived NO release, as well as that of morphine, suggesting that a novel mu opiate receptor was present and selective toward M6G.
Subjecting the marine bivalve M. edulis to an immediate temperature change has been shown to rapidly alter the animals’ ganglionic monoamine levels, opiate processes as well as its ciliary activity [71]. After 12 h cold exposure the estimated relative mu opiate receptor (MOR) gene expression in M. edulis pedal ganglia, measured by real-time PCR, did not differ significantly from the control group whereas 24 h of cold exposure significantly down regulated their mu opiate receptor mRNA expression and limiting nitric oxide release. Interestingly, morphine and DAMGO significantly enhances ciliary beating in a naloxone sensitive manner, whereas L-NAME, a nitric oxide synthase inhibitor, only antagonized morphine’s action [72]. This study strongly suggests that the two alternatively spliced mu opiate receptors may be involved in the physiological regulation of lateral ciliary activity in the visceral ganglia via dopamine and nitric oxide.
Incubation of M. edulis excised gill filaments reveal spontaneously lateral cilia beating in a meta-chronal wave, which was significantly decreased by morphine in a concentration dependent and naloxone reversible manner [73]. Exposure of the spontaneously beating cilia to SNAP, a NO donor, also diminished the beating rate. Exposing the cilia to L-NAME blocked the morphine induced cilio-inhibition, demonstrating that morphine was working to inhibit the cilia via NO. Furthermore, the gill tissue contained mu opiate receptor transcripts, which was mu3 in nature [73]. As in mammals, opiate signaling is not confined to neural tissues. This report demonstrates the occurrence of opiate signaling for the first time in an invertebrate’s respiratory tissue.

Mytilus edulis as a model for substance abuse screening
Based on the experimental data that Mytilus edulis ganglia make morphine and that perturbation of its environment, such as cold stress, bacteria infection, starvation, can alter its synthesis make it a likely model for testing substances of abuse [74]. We have designed an assay that can actually measure the effect of substances of abuse on morphine release from M. edulis ganglia [75-78]. Incubation of pooled M. edulis pedal ganglia with ethanol, cocaine or nicotine, substances with high substance abuse potential, resulted in a statistically significant enhancement of 125I-trace labeled morphine release [75-85]. Taken together, besides demonstrating the suitability of M. edulis as a model animal for influencing opiate processes Mytilus studies introduce the hypothesis that substance of abuse may all work, in part, by releasing endogenous morphine, which impacts the CNS reward and motor systems.

Conclusions
Thus, opioid peptides and opiate alkaloids, functioning in an autocrine/paracrine manner have not only been conserved during the course of evolution but their activities in immuno- and neuro-regulation have been conserved as well. Stereoselect degradation and dynamic receptor mechanisms also exist in invertebrates to insure that their signals exhibit the highest fidelity. The potential for immunocytes to communicate with neural and immune elements using opioid, opiate, cholinergic, GABAnergic and catecholamininergic, as well as cytokine, signal molecules also exists. Furthermore, “opiates” may be used, in part, by parasites to escape immune surveillance [86-88]. Thus, the comparative study, emphasizing M. edulis in this review, of chemical messenger associated regulation and its involvement in autoim-munoregulation represents a scientific area of timely interest, which will be the subject of future endeavors. These primitive receptors and the morphinergic signal molecules associated with them are likely affecting many underlying biochemical processes, including endocrine and within the scope of substance abuse [81, 89-91].

References
1. Boer HH, van Minnen J, Stefano GB, Leung MK. Opioid peptides in the central nervous system of Lymnaea stagnalis. In: Boer HH, Geraerts WP, Joosse J (eds). Neurobiology: Molluscan models. Amsterdam: North Holland Publishing Company 1987; 68-73.
2. Leung MK, Mixon B, Kuruvilla S, Stefano GB. Evidence for the presence of enkephalin precursor in pedal ganglia of Mytilus edulis. In: Boer HH, Geraerts WPM, Joosse J (eds). Neurobiology: Molluscan models. Amsterdam: North Holland Publishing Company 1987; 215-8.
3. Leung MK, Stefano GB. Comparative neurobiology of opioids in invertebrates with special attention to senescent alterations. Prog Neurobiol 1987; 28: 131-59.
4. Stefano GB. Opioid peptides-comparative peripheral mechanisms. In: Holmgren S (eds). Comparative Physiology of regulatory peptides. New York: Chapman and Hall 1989; 112-29.
5. Stefano GB, Leung MK, Zhao X, Scharrer B. Evidence for the involvement of opioid neuropeptides in the adherence and migration of immunocompetent invertebrate hemocytes. Proc Natl Acad Sci USA 1989; 86: 626-30.
6. Stefano GB, Cadet P, Scharrer B. Stimulatory effects of opioid neuropeptides on locomotory activity and conformational changes in invertebrate and human immunocytes: Evidence for a subtype of delta receptor. Proc Natl Acad Sci USA 1989; 86: 6307-11.
7. Stefano GB. Role of opioid neuropeptides in immunoregulation. Prog Neurobiol 1989; 33: 149-59.
8. Stefano GB, Leung MK, Zhao XH, Scharrer B. Evidence for the involvement of opioid neuropeptides in the adherence and migration of immunocompetent invertebrate hemocytes. Proc Natl Acad Sci U S A 1989; 86: 626-30.
9. Shipp MA, Stefano GB, D'Adamio L, et al. Downregulation of enkephalin-mediated inflammatory response by CD10/ neutral endopeptidase 24.11. Nature 1990; 347: 394-6.
10. Turner A, Leung MK, Stefano GB. Peptidases of significance in neuroimmunoregulation. In: Scharrer B, Smith EM, Stefano GB (eds). Neuropeptides in neuroimmunology. Springer-Verlag 1994; 152-69.
11. Paemen LR, Porchet-Hennere E, Masson M, Leung MK, Hughes TK, Stefano GB. Glial localization of interleukin-1a in invertebrate ganglia. Cell Mol Neurobiol 1992; 12: 463-72.
12. Stefano GB, Scharrer B, Smith EM, et al. Opioid and opiate immunoregulatory processes. Crit Rev in Immunol 1996; 16: 109-44.
13. Laurent V, Salzet M. Metabolism of angiotensins in head membranes of the leech Theromyzon tessulatum by peptidases. FEBS Lett 1996; 384: 123-7.
14. Laurent V, Salzet M. Identification and properties of an angiotensin-converting enzyme in the leech Theromyzon tessulatum. Peptides 1996; 17: 737-45.
15. Laurent V, Stefano GB, Salzet M. The leech angiotensin-converting enzyme. Ann N Y Acad Sci 1997; 839: 500-2.
16. Laurent V, Salzet M. A comparison of the N-terminal sequence of leech angiotenisn converting-like enzyme with forms of vertebrate angiotensin converting enzyme. Neurosci Lett 1998; 198: 60-4.
17. Stefano GB, Salzet M. Invertebrate opioid precursors: Evolutionary conservation and the significance of enzymatic processing. Int Rev Cytol 1999; 187: 261-86.
18. Leung MK, Stefano GB. Isolation and identification of enkephalin in pedal ganglia of Mytilus edulis (mollusca). Proc Natl Acad Sci USA 1984; 81: 955-8.
19. Stefano GB, Leung MK. Presence of met-enkephalin-Arg6-Phe7 in molluscan neural tissues. Brain Res 1984; 298: 362-5.
20. Salzet M, Stefano GB. Prodynorphin in invertebrates. Mol Brain Res 1997; 52: 46-52.
21. Salzet M, Stefano GB. Invertebrate proenkephalin: Delta opioid binding sites in leech ganglia and immunocytes. Brain Res 1997; 768: 224-32.
22. Goumon Y, Strub JM, Moniatte M et al. The C-terminal biophosphorylated proenkephalin-A-(209-237)-peptide from adrenal medullary chromaffin granules possesses antibacterial activity. Eur J Biochem 1996; 235: 516-25.
23. Stefano GB, Salzet-Raveillon B, Salzet M. Mytilus edulis hemolymph contain prodynorphin. Immunol Lett 1998; 63: 33-9.
24. Stefano GB, Kream RM. Endogenous morphine synthetic pathway preceded and gave rise to catecholamine synthesis in evolution (Review). Int J Mol Med 2007; 20: 837-41.
25. Stefano GB, Zhu W, Mantione K, et al. 17-beta-estradiol down regulates ganglionic microglial cells via nitric oxide release: Presence of a fragment for estrogen receptor beta. Neuroendocrinol Lett 2003; 24: 130-6.
26. Zhu W, Mantione K, Jones D, et al. The Presence of 17-betaestradiol in Mytilus edulis gonadal tissues: evidence for estradiol isoforms. Neuroendocrinol Lett 2003; 24:
137-40.
27. Roy JR, Chakraborty S, Chakraborty TR. Estrogen-like endocrine disrupting chemicals affecting puberty in humans – a review. Med Sci Monit 2009; 15: RA137-45.
28. Singh MN, Martin-Hirsch PL, Martin FL. The multiple applications of tamoxifen: an example pointing to SERM modulation being the aspirin of the 21st century. Med Sci Monit 2008; 14: RA144-8.
29. Stefano GB. Invertebrate and vertebrate immune and nervous system signal molecule commonalities. Cell Mol Neurobiol 1992; 12: 357-66.
30. Stefano GB, Paemen LR, Hughes TK Jr. Autoim-munoregulation: differential modulation of CD10/neutral endopeptidase 24.11 by tumor necrosis factor and neuropeptides. J Neuroimmunol 1992; 41: 9-14.
31. Stefano GB, Melchiorri P, Negri L, Hughes TK Jr, Schar-
rer B. [D-Ala2]deltorphin I binding and pharmacological evidence for a special subtype of delta opioid receptor on human and invertebrate immune cells. Proc Natl Acad Sci U S A 1992; 89: 9316-20.
32. Stefano GB, Scharrer B. Endogenous morphine and related opiates, a new class of chemical messengers. Adv Neuroimmunol 1994; 4: 57-68.
33. Stefano GB. Pharmacological and binding evidence for opioid receptors on vertebrate and invertebrate blood cells. In: Scharrer B, Smith EM, Stefano GB (eds). Neuropeptides and Immunoregulation. Springer-Verlag 1994; 139-51.
34. Stefano GB, Digenis A, Spector S, et al. Opiate-like substances in an invertebrate, an opiate receptor on invertebrate and human immunocytes, and a role in immunosuppression. Proc Natl Acad Sci USA 1993; 90: 11099-103.
35. Stefano GB, Bilfinger TV. Human neutrophil and macrophage chemokinesis induced by cardiopulmonary bypass: loss of DAME and IL-1 chemotaxis. J Neuroim-munol 1993; 47: 189-98.
36. Cadet P, Stefano GB. Mytilus edulis pedal ganglia express micro opiate receptor transcripts exhibiting high sequence identity with human neuronal micro1. Mol Brain Res 1999; 74: 242-6.
37. Cadet P, Mantione KJ, Stefano GB. Molecular identification and functional expression of mu3, a novel alternatively spliced variant of the human mu opiate receptor gene.
J Immunol 2003; 170: 5118-23.
38. Fricchione G, Zhu W, Cadet P, et al. Identification of endogenous morphine and a mu3-like opiate alkaloid receptor in human brain tissue taken from a patient with intractable complex partial epilepsy. Med Sci Monit 2008; 14: CS45-9.
39. Kream RM, Sheehan M, Cadet P, et al. Persistence of evolutionary memory: primordial six-transmembrane helical domain mu opiate receptors selectively linked to endogenous morphine signaling. Med Sci Monit 2007; 13: SC5-6.
40. Stefano GB, Kream RM, Esch T. Revisiting tolerance from the endogenous morphine perspective. Med Sci Monit 2009; 15: RA189-98.
41. Hughes TK, Smith EM, Cadet P, et al. Interaction of immunoactive monokines (IL-1 and TNF) in the bivalve mollusc Mytilus edulis. Proc Natl Acad Sci USA 1990; 87: 4426-9.
42. Hughes TK, Chin R, Smith EM, Leung MK, Stefano GB. Similarities of signal systems in vertebrates and invertebrates: Detection, action, and interactions of immunoreactive monokines in the mussel, Mytilus edulis. Adv Neuroimmunol 1991; 1: 59-70.
43. Hughes TK, Smith EM, Stefano GB. Detection of immunoreactive Interleukin-6 in invertebrate hemolymph and nervous tissue. Prog Neuroimmune Endocrinol 1991; 4: 234-9.
44. Hughes TK, Smith EM, Barnett JA, Charles R, Stefano GB. LPS and opioids activate distinct populations of Mytilus edulis immunocytes. Cell Tiss Res 1991; 264: 317-20.
45. Hughes TK, Smith EM, Barnett JA, Charles R, Stefano GB. LPS stimulated invertebrate hemocytes: a role for immunoreactive TNF and IL-1. Dev Comp Immunol 1991; 15: 117-22.
46. Stefano GB, Smith EM, Hughes TK. Opioid induction of immunoreactive interleukin-1 in Mytilus edulis and human immunocytes: An interleukin-1-like substance in invertebrate neural tissue. J Neuroimmunol 1991; 32: 29-34.
47. Stefano GB, Cadet P, Sinisterra JI, Scharrer B. Comparative aspects of the response of human and invertebrate immunocytes to stimulation by opioid neuropeptides. In: Stefano GB, Florey E (eds). Comparative aspects of neuropeptide function. Manchester: University of Manchester Press 1991; 329-34.
48. Stefano GB, Smith DM, Smith EM, Hughes TK. MSH can deactivate both TNF stimulated and spontaneously active immunocytes. In: Kits KS, Boer HH, Joosse J (eds). Molluscan Neurobiology. Amsterdam: North Holland Publishing Company 1991; 206-9.
49. Zhu W, Baggerman G, Goumon Y, Casares F, Browna-
well B, Stefano GB. Presence of morphine and morphine-6-glucuronide in the marine mollusk Mytilus edulis ganglia determined by GC/MS and Q-TOF-MS. Starvation increases opiate alkaloid levels. Brain Res Mol Brain Res 2001; 88: 155-60.
50. Zhu W, Ma Y, Stefano GB. Presence of isoquinoline alkaloids in molluscan ganglia. Neuroendocrinol Lett 2002; 23: 329-34.
51. Zhu W, Mantione KJ, Shen L, Stefano GB. In vivo and in vitro L-DOPA exposure increases ganglionic morphine levels. Med Sci Monit 2005; 11: MS1-5.
52. Zhu W, Mantione KJ, Shen L, et al. Tyrosine and tyramine increase endogenous ganglionic morphine and dopamine levels in vitro and in vivo: CYP2D6 and tyrosine hydroxylase modulation demonstrates a dopamine coupling. Med Sci Monit 2005; 11: BR397-404.
53. Zhu W, Stefano GB. Reticuline exposure to invertebrate ganglia increases endogenous morphine levels. Neuro Endocrinol Lett 2004; 25: 323-30.
54. Stefano GB, Mantione K, Jones D, Zhu W, Casares F, Ca-det P. Immunocytes modulate ganglionic nitric oxide release which later affects their activity level. Neuroendocrinol Lett 2004; 25: 57-61.
55. Zhu W. CYP2D6: a key enzyme in morphine synthesis in animals. Med Sci Monit 2008; 14: SC15-8.
56. Stefano GB, Kream RM. Dopamine, morphine, and nitric oxide: An evolutionary signaling triad. CNS Neurosci Therapeut 2009; in press.
57. Gu Y, Yun L, Tian Y, Hu Z. Association between COMT gene and Chinese male schizophrenic patients with violent behavior. Med Sci Monit 2009; 15: CR484-9.
58. Stefano GB, Stefano JM, Esch T. Anticipatory stress response: a significant commonality in stress, relaxation, pleasure and love responses. Med Sci Monit 2008; 14: RA17-21.
59. Sonetti D, Ottaviani E, Bianchi F, et al. Microglia in invertebrate ganglia. Proc Natl Acad Sci USA 1994; 91: 9180-4.
60. Pflueger A, Abramowitz D, Calvin AD. Role of oxidative stress in contrast-induced acute kidney injury in diabetes mellitus. Med Sci Monit 2009; 15: RA125-36.
61. De GC, Bianchi M, Pascale V, et al. Asymmetric dimethylarginine (ADMA): an endogenous inhibitor of nitric oxide synthase and a novel cardiovascular risk molecule. Med Sci Monit 2009; 15: RA91-101.
62. Tanii H, Higashi T, Nishimura F, Higuchi Y, Saijoh K. Effects of cruciferous allyl nitrile on phase 2 antioxidant and detoxification enzymes. Med Sci Monit, 2008; 14:
BR189-92.
63. Stefano GB, Hartman A, Bilfinger TV, et al. Presence of the mu3 opiate receptor in endothelial cells: Coupling to nitric oxide production and vasodilation. J Biol Chem 1995; 270: 30290-3.
64. Liu Y, Shenouda D, Bilfinger TV, Stefano ML, Magazine HI, Stefano GB. Morphine stimulates nitric oxide release from invertebrate microglia. Brain Res 1996; 722: 125-31.
65. Stefano GB, Scharrer B. The presence of the micro3 opiate receptor in invertebrate neural tissues. Comp Biochem Physiol 1996; 113C: 369-73.
66. Stefano GB, Liu Y. Opiate antagonism of opioid actions on immunocyte activation and nitric oxide release. Anim Biol 1996; 1: 11-6.
67. Sonetti D, Ottaviani E, Stefano GB. Opiate signaling regulates microglia activities in the invertebrate nervous system. Gen Pharmacol 1997; 29: 39-47.
68. Stefano GB, Goumon Y, Casares F, et al. Endogenous morphine. Trends in Neurosciences 2000; 9: 436-42.
69. Mantione K, Zhu W, Rialas C, et al. Morphine-6-glucuronide stimulates nitric oxide release in mussel neural tissues: Evidence for a morphine-6-glucuronide opiate receptor subtype. Cel Mol Life Sci 2002; 59: 570-4.
70. Atmanene C, Laux A, Glattard E, et al. Characterization of human and bovine phosphatidylethanolamine-binding protein (PEBP/RKIP) interactions with morphine and morphine-glucuronides determined by noncovalent mass spectrometry. Med Sci Monit 2009; 15: BR178-87.
71. Mantione K, Hong R, Im R, et al. Effects of cold stress on morphine-induced nitric oxide production and mu-opiate receptor gene expression in Mytilus edulis pedal ganglia. Neuroendocrinol Lett 2003; 24: 68-72.
72. Cadet P, Zhu W, Mantione K, Baggerman G, Stefano GB. Cold stress alters Mytilus edulis pedal ganglia expression of micro opiate receptor transcripts determined by real-time RT-PCR and morphine levels. Brain Res Mol Brain Res 2002; 99: 26-33.
73. Mantione KJ, Kim C, Stefano GB. Morphine regulates gill ciliary activity via coupling to nitric oxide release in
a bivalve mollusk: opiate receptor expression in gill tissues. Med Sci Monit 2006; 12: BR195-200.
74. Pryor SC, Zhu W, Cadet P, Bianchi E, Guarna M, Stefano GB. Endogenous morphine: opening new doors for the treatment of pain and addiction. Expert Opin Biol Ther 2005; 5: 893-906.
75. Zhu W, Mantione KJ, Casares FM, et al. Alcohol-, nicotine, and cocaine-evoked release of morphine from invertebrate ganglia: Model system for screening drugs of abuse. Med Sci Monit 2006; 12: BR155-61.
76. Zhu W, Mantione KJ, Shen L, Lee B, Stefano GB. Norlaudanosoline and nicotine increase endogenous ganglionic morphine levels: Nicotine addiction. Cell Mol Neurobiol 2006; 26: 1037-45.
77. Zhu W, Mantione KJ, Casares FM, Sheehan MH, Kream RM, Stefano GB. Cholinergic regulation of endogenous morphine release from lobster nerve cord. Med Sci Monit 2006; 12: BR295-301.
78. Zhu W, Mantione K, Kream RM, Stefano GB. Alcohol-, nicotine-, and cocaine-evoked release of morphine from human white blood cells: substances of abuse actions converge on endogenous morphine release. Med Sci Monit 2006; 12: BR350-4.
79. Stefano GB, Bianchi E, Guarna M, et al. Nicotine, alcohol and cocaine coupling to reward processes via endogenous morphine signaling: the dopamine-morphine hypothesis. Med Sci Monit 2007; 13: RA91-102.
80. Zhu W, Mantione KJ, Kream RM, Cadet P, Stefano GB. Cholinergic regulation of morphine release from human white blood cells: evidence for a novel nicotinic receptor via pharmacological and microarray analysis. Int
J Immunopathol Pharmacol 2007; 20: 229-37.
81. Zhu W, Esch T, Kream RM, Stefano GB. Converging cellular processes for substances of abuse: endogenous morphine. Neuro Endocrinol Lett 2008; 29: 63-6.
82. Yokoyama H, Hirose H, Saito I. Two types of unsafe drinker judged to have metabolic syndrome: typical metabolic syndrome or alcohol-related syndrome? Med Sci Monit 2009; 15: H57-64.
83. Yokusoglu M, Sag C, Cincik M, et al. Perindopril, atenolol, and amlodipine prevent aortic ultrastructural changes in rats exposed to ethanol. Med Sci Monit 2008; 14: BR96-102.
84. Naha N, Lee HY, Naser MI, Park TJ, Kim SH, Kim MO. Ethanol inhibited apoptosis-related RNA binding protein, Napor-3 gene expression in the prenatal rat brain. Med Sci Monit 2009; 15: BR6-12.
85. Castardeli E, Duarte DR, Minicucci MF, et al. Exposure time and ventricular remodeling induced by tobacco smoke exposure in rats. Med Sci Monit 2008; 14: BR62-6.
86. Goumon Y, Casares F, Pryor S, et al. Ascaris suum, an intestinal parasite, produces morphine. J Immunol 2000; 165: 339-43.
87. Pryor SC, Putnam J, Hoo N. Opiate alkaloids in Ascaris suum. Acta Biol Hung 2004; 55: 353-61.
88. Zhu W, Pryor SC, Putnam J, Cadet P, Stefano GB. Opiate alkaloids and nitric oxide production in the nematode Ascaris suum. J Parasitol 2004; 90: 15-22.
89. Nikisch G. Involvement and role of antidepressant
drugs of the hypothalamic-pituitary-adrenal axis and glucocorticoid receptor function. Neuro Endocrinol Lett 2009; 30: 11-6.
90. Kopeckova M, Paclt I, Petrasek J, Pacltova D, Malikova M, Zagatova V. Some ADHD polymorphisms (in genes DAT1, DRD2, DRD3, DBH, 5-HTT) in case-control study of 100 subjects 6-10 age. Neuro Endocrinol Lett 2008; 29:
246-51.
91. Gavrilovic L, Spasojevic N, Tanic N, Dronjak S. Chronic isolation of adult rats decreases gene expression of catecholamine biosynthetic enzymes in adrenal medulla. Neuro Endocrinol Lett 2008; 29: 1015-20.
Copyright: © 2009 Termedia & Banach. This is an Open Access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International (CC BY-NC-SA 4.0) License (http://creativecommons.org/licenses/by-nc-sa/4.0/), allowing third parties to copy and redistribute the material in any medium or format and to remix, transform, and build upon the material, provided the original work is properly cited and states its license.
Share